| | | |
Uploading ....
Support - Central not starting
- Probe not starting
- Probe not polling
- Problem in receiving data from Probe
- A particular Probe unable to connect to the Central
- SNMP Settings
- Opening ports in Windows Firewall
- Availability showing as red in probe and central
- Error # RPC Server Not Available
- Authentication Failure
- DMSID already exists
- Disable Automatic Rediscovery
- Event Log Rules
- Remove DB entries
- MySQL Upgrade Failure
- NAT Name
- pdlastvalues
- 7100 PPM Problem - Central
- 7100 PPM Problem - Probe
- Desktop Central Agent Installation
- System Monitoring : Central Server state directory. Severity : Critical
- Devices are displayed in Probe but not displayed in central, post initial discovery
- Pre-Upgrade Steps
- Dcconfig.exe error ---Desktop Management agent issue
- CreateProcessAsUser Failed----Remote control issue
- Device availability graph is shows that device is 0% available (fully red)
- Error while fetching response for URL
- Receiving errors while executing startdms.bat on the Probe
- Unable to install the agent on some devices
- Procedures to install GODADDY SSL certificate (tomcat) in MSP Center plus
- Agent successfully installed but not available in the Central web client
- Central/Probe service does not start after upgrade to build 7201
- 7100 to 7201 upgrade issue
- 7100 exe to 7201 or 7101 exe to 7201 upgrade issue
- 6005/7002/7003/7004/7005 build to 7201 upgrade issue
- 7101-> 7201 upgrade issue
- In Resource monitors report, CPU, Memory & Disk monitors are shown twice
- Probe failing to start after upgrading the Central to 7200 & 7201
- Agents of size 0KB created
- Procedures to remove the database entries of a device already added --(Remove DB Entries) ---->(Build 7100 and above)
- Procedures to run Mysqlcheck (Advanced database repair)
- Procedures to install SSL Certificate (tomcat) from Network Solutions
- Probe not starting due to Socket Exception. No buffer space available
- Probes not upgrading to 7202 ppm (only for 7200 ppm upgrade)
- Issue in adding file monitor
- Daylight savings
- Log analyzer output
- Steps to take thread dump
- Problem with SMS Notification
- Communication with the Central server down since
- Data not shown for all the interfaces
- com.mysql.jdbc.CommunicationsException error
- Troubleshooting CLI monitors
- Error in download client from BE
- NTLM URL monitor domainname null issue
- Device Availability Graph showing incorrect data
- Issue in fetching correct hard disk size
Central not starting
Find below some of the most common reasons that prevent central server from starting. If anything below matches your case please try the suggested remedial action. - Antivirus software blocking MySQL
MSPCenter uses MySQL version 5 which fails to start when McAffee, Symantec kind of AntiVirus tools lock the mysql files while scanning. So please exclude central/mysql folder from your antivirus scan. - Backup software blocking MySQL
Same case as above. MySQL doesn't like your backup agent either. Stop your backup agent and then start MSP Center. - Windows firewall blocking Java.exe, MySQL.exe
Sometimes if you fail to notice the popup that prompts you to unblock the MSPCenter java and mysql executables then central won't start. - Unable to start MySQL - port occupied
MySQL wont start if its default port 23306 is occupied by some other service such as a blackberry server. So please check if anyother service is occupying port 23306 and if it does so, stop it. - Unable to start MySQL loopback not resolving
Open the file c:windowssystem32driversetchosts.FILE . Check if 127.0.0.1 is pointing to localhost. If not add this entry. Also open c:programfilesadventnetmecentralconfdatabase_params.conf and change url jdbc:mysql://localhost:23306 to url jdbc:mysql://127.0.0.1:23306. - Not enough hardware resources
For production systems we recommend 4GB of RAM dedicated for MSPCenter. If you are just trying the product ensure that atleat 2GB of RAM is available for the MSP Center. Anything less than this might result in slow performance or failure to start. - Tomcat port 443 occupied
MSP uses port 443 for tomcat by default. Before launching the client MSP will check whether the port is FREE; if the port is occupied by any other process then central will fail to start - Central's IP address changed
Central server references the machine's IP address in a conf file and tries to connect to itself before launching. If the IP address of the server is modified then central wont start. - Improper third party certificate
Central will try to connect to itself using ssl during the startup process. this process gets stuck if the certiciate is not proper. - EventDB table size grown beyond limit
Sometimes unwanted traps flood causes EventDB to grow to few GB in size causing trouble while starting. - Improper shutdown
Sometimes when the product is shutdown during partial startup process it creates problems while restarting. If you still have the problem after following the above steps please do the following - Start the product in command prompt and send us a screenshot
- Zip and email the central/logs folder to us
Probe not Starting
Some of the common reasons for probe not starting are - Incorrect central IP referred in probe/conf/NOCServerDetails.xml
Ensure that the APACHE_NAME in probe/conf/NocServerDetails.xml points to the right central IP/url - Antivirus software blocking MySQL
MSPCenter uses MySQL version 5 which fails to start when McAffee, Symantec kind of AntiVirus tools lock the mysql files while scanning. So please exclude central/mysql folder from your antivirus scan. - Backup software blocking MySQL
Same case as above. MySQL doesn't like your backup agent either. Stop your backup agent and then start MSP Center. - Windows firewall not allowing java.exe or mysql.exe
Sometimes if you fail to notice the popup that prompts you to unblock the MSPCenter java and mysql executables then central won't start. - MySQL port occupied
MySQL wont start if its default port 23306 is occupied by some other service such as a blackberry server. So please check if anyother service is occupying port 23306 and if it does so, stop it. - Loopback not resolving
Open the file c:windowssystem32driversetchosts.FILE . Check if 127.0.0.1 is pointing to localhost. If not add this entry. Also open c:programfilesadventnetmecentralconfdatabase_params.conf and change url jdbc:mysql://localhost:23306 to url jdbc:mysql://127.0.0.1:23306. - Not enough hardware resources
For production systems we recommend 4GB of RAM dedicated for MSPCenter. If you are just trying the product ensure that atleat 2GB of RAM is available for the MSP Center. Anything less than this might result in slow performance or failure to start. - Port 443 occupied
MSP uses port 443 for tomcat by default. Before launching the client MSP will check whether the port is FREE; if the port is occupied by any other process then central will fail to start. - Probe machine's ip address changed
Probe server references the machine's IP address in a conf file and tries to connect to itself before launching. If the IP address of the server is modified then probe wont start. - Certificate applied on central but files not copied on probes
If you have applied any SSL certificate on the central server recently, then please do the following 1) stop the probe service 2)go to start->run->cmd 3) execute sslgen.bat from c:programfilesadventnetmeprobein folder and then 4)start the probe server by executing startdms.bat from c:programfilesadventnetmeprobein folder - Communication between central and probe is not stable
This happens rarely for some customers if they are using a weak network connection or something - Probe and central are in different version
Go to start->run->cmd and then execute c:programfilesadventnetmeprobeinstartdms.bat. This will start the probe and will also tell you if both probe and central are in same version or different version. If the problem doesn't solve with the above tips, do the following - Stop the service
- Go to start->run->cmd and then launch probe/bin/startdms.bat
- Send us a screenshot of the command prompt
- Zip the probe/logs folder and email that to us
Probe not polling This is a critical alert which refers to a state where the probe has stopped polling for all devices because of a WMI thread locking issue caused by some bad device. To rectify this issue please go through the following presentation Possible problem in receiving data from {probename}. Data is not received for last x hrs y mins.
- first check if the devices monitored by these probes are showing the current data (ex: open a device snapshot page and click on the cpu dial and check )
- if the data is not current then
- it means the probe is not sending the data to central.
- go to probe machine and see if the probe/data/ folder has large number of files in it
- restart probe in command prompt mode (probe/bin/startdns.bat) and check if the above folder reduces in size
- if the data is current then
- it could be a false alarm generated by the following
- there is no such active probe : you might have created a probe earlier and then deleted it. but the folder is still available under centraldata eceived directory
- duplicate probe : you might have created a Probe with the same name and would have deleted it earlier. But the folder of the old Probe will is still available under centraldata eceived.
- Steps to solve the above problems
- Please go to this path: Program FilesAdventNetMEcentraldata eceived and check whether there is any other folder other than the active probes which are in admin->probes list
- From Central web client go to Network monitoring>Admin>Probes and delete the old probe if it is present.
- Then clear the alarm.
A Particular Probe unable to connect to the Central
Steps to solve the issue: - Try to login to the central web client from that probe (which does not communicate which the central). If you could connect then there is no issue with the communication.
- Open the NocServerDetails.xml [probeconf] file of the probe and check whether the NOCServerName is the same that of Central's IP/NAT IP. If not then change the NOCServerName. Restart the Probe once. Now the Probe could able to connect to the Central.
If still the Probe could not communicate with the Central, then do the following: - Rename the Probe's logs folder [probe].
- Start the Probe from the command prompt using startdms.bat [probein].
- Send us the new logs.
SNMP Settings If the device is categorizing itself as a desktop on discovery then it means that the SNMP is not turned on in that device or you are discovering the device with a wrong community string.
Steps to solve the issue: - Go to the End device which you are monitoring and go to services.msc.
- Check whether the SNMP service is installed and running.
- If yes then go to properties of SNMP service and under security tab check the read community string.
- Accept SNMP packets from any host should be checked, If the second option is checked then the ip/name of the probe server should be entered there.
- While discovering the device make sure you provide this community string.
Opening ports in Windows Firewall You can create exceptions (open ports in other words) in your Windows Firewall so that SNMP, WMI or other desired traffic can flow through without having to shutdown the firewall.
Follow the steps below to create exceptions: - Start->Run->Firewall.cpl in the end machine which you need to access from MSP Center Probe
- Open the exceptions tab
- Click on Add Port
- Give the port name (your choice ex: SNMP, WMI etc) and port number
- Ports for SNMP : UDP 161 and UDP 162
- Port for WMI : TCP 135, and TCP 445
Availability showing as red in probe and central The availability issue is a known issue and follow the steps given below to troubleshoot it. - Login to the probe and in the command prompt goto probemysqlin and execute,
mysql.exe -u root -P 33306 dmsdb - Then execute,
delete from downtimestart where elementid in (you need to list of elementid's of devices for which availability is showing as red);
eg.: delete from downtimestart where elementid in (value1,value2.......); - Restart the Probe. This should solve the issue.
To know the elementid, - Open Submit Query.
- Execute select * from managedobject where displayname like 'devicename'
- Now select the moid value and Similarly collect the moid value for all other devices which are having the problem
Error # RPC Server Not Available This is a WMI issue and some of the common reasons for WMI not working are given below: - WMI service is not running
To solve this go to start->run->services.msc and look for Windows Management Instrumentation service. If this is stopped, start the service. If it is already running you can try restarting it. - The password used is incorrect
Sometimes the password you use could be incorrect. Please ensure that you provide username in this format domainname/username and not just username for the devices. - Windows firewall is blocking WMI traffic
Please stop windows firewall so that WMI can work. Or else you can just open the WMI port 135 and 445 for both inbound and outbound - DCOM is not configured
Do the following in the device that is to be monitored via WMI. Go to start->run->dcomcnfg to launch component services windows. Expand console root->component services->computer. Right click computers and choose properties. Choose default properties in the property window. Enable 1) Distributed com and 2)Com internet services. Set the default authentication level to default. Set the default impersonate level to impersonate. - Security policy not configured
Do the following in the device that is to be monitored via WMI. Go to start->run->secpol.msc. Expand security settings-> local policies->security options. In the right side UI look for "network access sharing and security model". Ensure that it is "classic local users" - local users can authenticate as themselves. - Check whether WMI is working via the WMIMGMT tool
Go to start->run->wmimgmt.msi. Right click on the WMI Control(Local) and choose connect to another computer. Give the target machine's name here and click OK. Now on the left hand side you should see WMI Control (target machine). Now right click and choose properties. If you see any error in the UI it means WMI is not fully configured in that machine. - Check if probe is installed on administrator login or user login
While installing the probe if you have installed as a user than an Administrator then this problem might occur. So go to start->run->services.msc and right click on the ManageEngine MSP Center Probe service and provide the LOGON details. Authentication Failure - The authentication failure is a trap generated from the end device which is picked up by MSP and converted into an alarm.
- The authentication failure alarm generates when any monitoring system is trying to query the device with a wrong community string, it might be MSP or any other monitoring system in the network.
- Please make sure in all the monitoring systems you have the right community string for the devices which are creating the authentication failure alarms.
- If you do not want to receive traps from the device, then go to that device and remove the probe IP/Name from the trap destination.
DMSID Already Registered
Reason: This error occurs when when you have installed a new Probe which carries the same name of an existing Probe irrespective of whether it is in use or deleted/uninstalled for some reasons.
Steps to solve the issue: - Create a new Probe under network monitoring>admin>probes.
- Then download the probe key and extract it over the probeconf folder.
- Run ssl_gen -f present under probein from command prompt.
- Start the Probe it should be fine.
Note: If it is the old Probe then try to restart the Central and then try to start the New Probe. Disable Automatic Rediscovery Automatic discovery happens every 14days once and all the devices in the network are added irrespective of whether it is new or ignored devices.
To stop the automatic rediscovery - Open the seed.file from centralconf and probeconf.
- In that file search for REDISCOVERY="TRUE" and change it to REDISCOVERY="False". You need to do it on all the probes.
- Then restart the Probe and the Central for the changes to take effect.
Event Log Rules - Check if the given username and password is correct. Select "Windows Service Monitors -> Add Monitor" from the Device snapshot page and choose "Click here to list services from this device". You should get the list of services in this device. Else, the given username and password is incorrect. Or, the DCOM Configuration is not improper.
- In Admin > Event Log rules, ensure that "Any application event" is not ignored.
- Try clearing the events from the Event Viewer and start monitoring the event log rules.
- Ensure that the option "Monitor event log for this device" is enabled in the Device Snapshot page through Actions -> Event Log rules. Also, select the event logs that you wish to monitor.
If you still face any issues, then contact us. Remove DB Entries - Device Allready Exists Issue: While adding a new device to the network, it will prompt with the error "Device already exist".
Reason: This happens in case of partial data removal of the same device from the database.
Resolution:
- Extract this MSPRemoveDBEntries.Zip file to the Central installation directory. This will create a new folder "RemoveDBEntires" and 4 files will be kept under that folder.
- Run the script RemoveDBEntries.bat both using IP Address and Device name. Make sure the server is running, when you execute the script. This script will remove the partially added entries from the database.
RemoveDBEntries script accepts the device name and ip address as argument.
cmd> cd [Central/Probe Home]/RemoveDBEntries cmd> RemoveDBEntries.bat IPaddress cmd> RemoveDBEntries.bat <devicename>
Example: RemoveDBEntries.bat">CentralRemoveDBEntries>RemoveDBEntries.bat 192.168.12.34 RemoveDBEntries.bat">CentralRemoveDBEntries>RemoveDBEntries.bat rex.india.com RemoveDBEntries.bat">ProbeRemoveDBEntries>RemoveDBEntries.bat 192.168.12.34 RemoveDBEntries.bat">ProbeRemoveDBEntries>RemoveDBEntries.bat rex.india.com Note: You need to remove the device both from the central as well as probe database .. , and readd from the probe side. - After executing the script, please restart OpManager service and add the device.
Note: It may take couple of minutes to view the newly added device. MySQL Upgrade Failure Follow the steps given below if you find some issues while upgrading MySQL of Probe server: - Stop the Probe service.
- Open Task Manager and "End" the java.exe, mysqld-nt.exe, wrapper.exe processes.
- Open the command prompt and execute the following :
cmd> cd [Probe-Home]in cmd> startmysql.bat - Open another command prompt and execute the following :
cmd> cd [Probe-Home]mysqlin cmd> mysqldump.exe -u root -P 33306 --skip-lock-tables --databases dmsdb > mysqlbackup-dmsdb.sql - Move the file 'mysqlbackup-dmsdb.sql' from [Probe-Home]mysqlin to [Probe-Home] folder
- Open another command prompt and execute :
cmd> cd [Probe-Home]in cmd> stopmysql.bat - Exit from all command prompts so that the folder [Probe-Home]mysqlin is not in use.
- Rename [Probe-Home]mysql folder as [Probe-Home]mysql-old
- Download the mysql version 5 from the url:
http://bonitas.zohocorp.com/customer_uploads/2009_9_11_11_24_45_mysql_windows.zip - Extract this zip in the [Probe-Home] folder. Move the [Probe-Home]mysql_windowsmysql to [Probe-Home] folder. [ ie., [Probe-Home]mysql folder should contain bin, data, share etc... ]
- Rename the file 'startmysql.bat' in the [Probe-Home]in folder as 'oldstartmysql.bat'.
- Download the attached startmysql.txt file as 'startmysql.bat' in the [Probe-Home]in folder. [ You have to rename the .txt extension as .bat. This is possible through the command prompt with the command 'move startmysql.txt startmysql.bat' in the [Probe-Home]in folder ]
- Open a command prompt and execute :
cmd> cd [Probe-Home]in cmd> startmysql.bat [ Note that the new startmysql.bat file is executed ] - Open another command prompt and execute :
cmd> cd [Probe-home]mysqlin cmd> mysql.exe -u root -P 33306 < ....mysqlbackup-dmsdb.sql
Wait until you get back to the command prompt. - Execute these commands in the same command prompt:
cmd> mysql.exe -u root -P 33306 dmsdb mysql> ALTER TABLE MailServer ADD COLUMN SECUREMODE BOOLEAN; mysql> UPDATE MailServer SET SECUREMODE=false; mysql> exit - Open another command prompt and execute the commands :
cmd> cd [Probe-Home]in cmd> stopmysql.bat - Execute these commands in another command prompt :
cmd> cd [Probe-Home]in cmd> UpdateManager.bat - Follow the on-screen instructions to install the service pack.
- Once the upgrade is complete, Start the probe from the command prompt as in
cmd> cd [Probe-Home]in cmd> startdms.bat NAT Name Please follow the steps below to fix the remote control issue. - Open the File Serverparameters.conf under centralconf.
- Change the NAT_NAME and NAT_PORT to the Public IP of your central server and port on which your central server is running respectively.
- Remove the '#' symbol before the NAT_NAME and NAT_PORT.
For ex: #NAT_NAME Enter_NAT_Name change it to NAT_NAME 69.112.12.23. #NAT_PORT 443(or the port on which central server is running) pdlastvalues - Download and extract the pdlastvalues-fix.zip file to the following path on the Central server.
centralclasses - Restrart the Central service once. This should fix the issue.
Note: Follow the same procedures on the Probes as well. Extract the contents of pdlastvalues-fix.zip file under probeclasses. 7100 PPM Problem - Central Please do the following steps in your Central server to solve the 7100 upgrade problem - Stop the central server
- Run the centralinackupackupdb.bat
- Start MySQL
- download the batch file from the link below and save it to C:ProgramFiles AdventNetMECentral7100upgradefix.bat.
http://bonitas.adventnet.com/customer_uploads/2009_4_21_12_52_52_upgradefix.rar - Execute the batch file.
- Send the following files to support@mspcenterplus.com : 1) CentralDuplicateEntries.txt and 2) CentralconfdoGraphToPollMap.xml
7100 PPM Problem - Probe Please do the following steps in your Probe server to solve the 7100 upgrade problem - Stop the probe server.
- Download and save the upgradefix.bat file under Probe directory from the below link.
http://bonitas.adventnet.com/customer_uploads/2009_4_21_12_52_52_upgradefix.rar - Go to Probe/bin> and execute startMySQL.bat.
- Go to Probe/> dir and execute the batch in Probe upgradefix.bat file.
- Go to Probe bin and execute stopMySQL.bat.
- Send us the DuplicateEntriesProbe.txt file under the probe directory
- Also send us the graph to poll map from probeconfdo.
Send us these two files from all the probes, we will do the changes and send you the file. Desktop Central Agent Installation Perform the below mentioned steps before installing new agents: - Go to services.msc in the central machine.
- Open the properties of "ManageEngine Desktop Central 6"
- Click on Log on tab and provide the administrative user name and password.
- Restart the central service.
- Go to MSP Dashboard and click on a particular customer.
- Click on Recreate agent button. Do it for all the customers.
- Now download a new MSI file of Desktop Central agent from central and then try to install the agent.
- Remove the agent which is already installed and then install it using the new MSI file.
System Monitoring : Central Server state directory. Severity : Critical This happens because some of the data in the central server is not processed. Please stop the central service and run repairdb.bat from central/state/buffer folder and this alarm will be cleared. Devices are displayed in Probe but not displayed in central, post initial discovery
Possible Reasons: - Discovery process might still continue in the Probe. Wait for some time (20 to 30 minutes) and then check the Central.
- Discovered devices might have fallen under some other category in the Central. In the Central search the devices by their IP Address. If not, also search by network.
If still the devices are not displayed in the Central, then contact us. Pre-upgrade steps Here are the things you have to do before you start the upgrade : - Ensure that you have atleast 10 GB of free space in the Central and Probe server for the upgrade.
- Ensure that a folder backup of the Central and Probe installation is done prior to the upgrade.
- Ensure that the Central and Probe are communicating properly through a manual check on the number of files to be sent to the central from the probe in the [probe-home]data ilestoSend folder. The number of files should preferrably be less than 5. Else, stop the probe service, start the probe from the command prompt through [Probe-Home]instartdms.bat and wait until all the files are sent.
- Once these are done, you can start the upgrade all by yourself and in case, you land into any problems, call the support staff @ 1-925-965-6200 for immediate assistance. Immediate assistance should be accompanied with Remote access to the Central server so that debugging the failure and starting the upgrade from thereon, would be easier.
Dcconfig.exe error ---Desktop Management agent issue
Steps to Troubleshoot: Download the attached file (dcconfig.exe) You need to place this file on every machine on which you are getting the dcconfig.exe popup
Please follow the procedures below to place this file
1)Save this file on the following path on the machines where you are getting the dcconfig.exe pop-up. /Program files/desktopcentral_agent
2)Watch for any further dcconfig.exe pop-ups on those machines and let us know if the pop-ups re-appear.
CreateProcessAsUser Failed----Remote control issue
Problem: remote control doesn't work.
Symptoms: - On clicking "connect" it says "Connect Anyway. Windows remote control active.". But clicking on "connect anyway" doesn't work.
- On clicking connect it says "unable to connect"
Log print:
Open the log file desktopcentral_agentlogsdcservices.log and see check for an error print ">>>>>>>>>>>>CreateProcessAsUser is Failed - Error code: 87<<<<<<<<<<<<<<<<<<<<<<<"
Solution: - Stop the agent services "ManageEngine Desktop Central 6 - Remote Control" and "ManageEngine Desktop Central 6 - Agent"
- Rename desktopcentral_agentindcrdservice.exe to dcrdservice.exe.old
- Download this file dcrdservice.exe
- Save it under desktopcentral_agentin folder.
- Start the agent services
Device availability graph shows that device is 0% available (red)
Issue : Device availability graph shows that device is 0% available (red) , though the device status is clear and the device is pingable from the probe .
Solution: Please follow the procedures below
1)Connect to the database of the probe that monitors the device whose availability graph is red , by following the procedures in the link below
http://help.mspcenterplus.com/Connecting-to-MySQL-DB.html
2)Execute the below query
select * from managedobject where displayname like '%<name of the device>%';
Make a note of the value present in the moid field in the output for the above query, where the name column contains the name of the device (Ignore the names that start with IF-<name of the device> and also the ones that end with a port number ----like <name of the device_port25>).
Example Query: select * from managedobject where displayname like '%vcenter.india.adventnet.com%';
vcenter.india.adventnet.com--- is the name of the device
Example output :
moid name 10000000507 vcenter.india.adventnet.com.attprobe 10000007022 vcenter.india.adventnet.com.attprobe_Web_80
The moid value that has be noted down from the above output is 10000000507. (You need to ignore the second one as stated above . )
3)Now execute the below query
delete from downtimestart where elementid=<output from the first query>;
example :
delete from downtimestart where elementid=10000000507;
4)Restart the probe service once .
The device availability data should be collected in an hour time for the current date and time . Error While Fetching Response for URL
Possible Reasons: - Port number mentioned in the ports.properties file [/program files/adventnet/me/central/conf] may be wrong from the actual port number used
- Some application could be using the port
Follow the steps given below to troubleshoot this error: - Open ports.properties file [/program files/adventnet/me/central/conf] and check whether the helpdesk port number has been changed.
SCP_WEBSERVER_PORT=8080 (8080 is the default port) - If the port number has changed, then change it back to the original port number and save the file.
- Restart the services for the changes to take effect.
- Check If the helpdesk port is occupied by some other application
- If another application is using the port , then free the port and restart the "Manageengine opmanager central" service and all other Manageengine services.
- Check if the "Manageengine supportcenter" service stays up and running.
If the problem still exists send us the entire logs directory (zipped) [/program files/adventent/me/central/supportcenter/server/default].
Receiving errors while executing startdms.bat on the Probe
Solution1: Follow the procedures given below: - Stop the "Manageengine opmanager probe" service
- Open a command window and terminate java.exe and mysqld-nt.exe processes if they are running
- Open a command window and navigate to /program files/adventnet/me/probe/bin
- Execute the command repairdb.bat
eg:, /program files/adventnet/me/probe/bin>repairdb.bat - Start the probe again
Solution2: If you still face the same problem please follow the procedures in the link below to run mysqlcheck on this probe . http://support.opmanager.com/AddSolution.sd?solID=29102 (follow the instructions for executing this on the probe only )
Solution3: - Login to the probe and goto the following location Probemysqldatadmsdb
- Search for pdlastvalues and delete all the frm,myd and myi of those files.
- If you have pdlastvalues01,pdlastvalues02 and pdlastvalues03 then delete all of them.
If the problem still persists please contact our support team [support@mspcenterplus.com] with the entire log folder (zipped , .zip file) from the following path "/program files/adventnet/me/probe"
We will analyze and update you. Unable to install the Agent on some devices
Check the following: - Check whether any antivirus software is running during the installation. If so, then stop it and try installing the Agent again.
- If you are installing the Agent on Windows Vista devices, then disable the User Account Control and try installing the Agent again. Kindly use below mentioned command to install the agent in your machine and send us the "install.log" file. This will be very helpful for us to analyze the issue further.
msiexec /package "c:DesktopCentralAgent.msi" /lex c:install.log
Procedures to install GODADDY SSL certificate in MSP Center plus
Procedure for getting Godaddy SSL Certificate for Tomcat webserver:
Central Server: Following commands are to be executed from the command prompt in the directory <Central_Home>jrein (Central_Home will be commonly C:Program FilesAdventNetMECentral)
Step 1 :
C:AdventNetMECentraljrein>keytool.exe -keysize 2048 -genkey -alias CentralSSL -keyalg RSA -keystore server.keystore (Godaddy needs a CSR to be generated with a keylength of 2048 or 4096)
Enter keystore password: (enter password, for example : storepw) What is your first and last name? [Unknown]: (enter the domainname with which you want to connect , for example : (mspcenterplus.com)
What is the name of your organizational unit? [Unknown]: (enter the name of your organization, for example : MSPCenterPlus)
What is the name of your organization? [Unknown]: (enter the name of your organization, for example : zohocorp or MSPCenterPlus)
What is the name of your City or Locality? [Unknown]: (enter the name of the city, for example : Austin, New York, Hounslow, Hammersmith etc..)
What is the name of your State or Province? [Unknown]: (enter the name of state the above city belongs to, for example : Texas, New York, London etc..)
What is the two-letter country code for this unit? [Unknown]: (enter the two letter country code for the state, for example : TX, NY, LN etc..) Is CN=www.mspcenterplus.com, OU=MSPCenterPlus, O=AdventNet, L=Austin, ST=Texas, C=TX correct? [no]: Yes
Enter key password for <CentralSSL> (RETURN if same as keystore password): storepw
Step 2 :
C:AdventNetMECentraljrein>keytool.exe -certreq -keyalg RSA -alias CentralSSL -file certreq.csr -keystore server.keystore (Creates the certreq.csr , which is to submitted to the CA for obtaining certificates) Enter keystore password: storepw
(Take a backup of the server.keystore AND certreq.csr , located in the path <Central_Home>jrein for re-use , if you need to starover again from beginning due to some error in the upcoming steps)
Step 3 :
Use the Certificate Service Request file, as in step 2, certreq.csr file, to generate the SSL Certificates for your domain ( in this example, it is www.mspcenterplus.com )
Further down, the steps listed are those associated with GoDaddy. The steps differ based on the SSL Provider you choose.
Step 4 :
Installing Root certifcate [The root certifcate valicert_class2_root.cer can be downloaded from the following link https://certs.godaddy.com/anonymous/repository.seam (we do not support DER format)]
C:AdventNetMECentraljrein>keytool.exe -import -alias root -keystore server.keystore -trustcacerts -file c:cert alicert_class2_root.crt {c:cert is the path where the valicert_class2_root.crt file is present} Enter keystore password: storepw
Certificate was added to keystore
Step 5 :
Installing gd_cross_intermediate certifcate
C:AdventNetMECentraljrein>keytool.exe -import -alias cross -keystore server.keystore -trustcacerts -file c:certgd_cross_intermediate.crt Enter keystore password: storepw
Certificate was added to keystore
Step 6 :
Installing gd_intermediate certificate
C:AdventNetMECentraljrein>keytool.exe -import -alias intermed -keystore server.keystore -trustcacerts -file c:certgd_intermediate.crt Enter keystore password: storepw
Certificate was added to keystore
Step 7 :
Installing certificate specific to your domain
C:AdventNetMECentraljrein>keytool.exe -import -alias CentralSSL -keystore server.keystore -trustcacerts -file c:certmanagedonline.net.crt (example) Enter keystore password: storepw
Certificate reply was installed in keystore
Step:8
C:AdventNetMECentraljrein>keytool -export -keystore server.keystore -alias CentralSSL -storepass storepw -file e: emp.cer (e: emp.cer is the path where the keystore is exported temporarily) Certificate stored in file <e: emp.cer> Step :9
C:AdventNetMECentraljrein>keytool -import -keystore https.truststore -alias CentralSSL -file e: emp.cer -storepass storepw (Imports the keystore to the file https.truststore) If you get an error java.lang.exception , then rename the https.truststore file present in the path C:AdventNetMECentraljrein> to https.truststore_old and then redo Step:9
Step : 10
Copy the https.truststore file in the <Central_Home>jrein directory to the <Central_Home>confprobedefaultToNewProbesconf and <Central_Home>conf directories.
Step :11
Copy the server.keystore file in the <Central_Home>jrein directory to the <Central_Home> omcatconf directory.
Step 12 : Restart the central server.
Probe Server:
1. Copy the https.truststore file from <Central_Home>conf directory to <Probe_Home>conf directory. 2. Execute the batch file in the <Probe_Home>in directory with the command " ssl_gen.bat -f ".
Reference: http://help.godaddy.com/
Agent Successfully installed but not available in Central web client
Is your Central installed on Windows server 2008. If so then a few additional configurations have to be done. Follow the steps given below:
- Login to the WIN 2008 server where the central is installed. Open the Services window [Click on Start ----->run and type services.msc].
- Right click on the service named ManageEngine Desktop Central 6 and click on Properties.

- Now click on the Log On tab and provide the administrator user-name and password for this machine.
 - Restart all the Manageengine services running on the central server .
- Login to the MSP Dashboard page and click on the name of the customer on whose computer you wish to install the agent on.

(Note : Agents are customer specific . An agent created for one customer cannot be used for another customer) - Click on the Recreate Agent button to recreate the agent.
 - Save the Newly created agent and use that for any further installations for this customer.
If still the problem exists, then it could also occur when you provide wrong IP address or name of the Central server while installing the Agent. To view the Central's IP address or name that is registered in the probe follow the steps given below: - Open Registry Editor.
- Navigate to HKLMsoftwareAdventnetDesktopCentralDCAgent.
 - Look for the Central's IP Address or Name.
Steps to Troubleshoot: Go through the following presentation to know steps to change the Central's IP Address or Name that is registed in the Agent.
Central/Probe service does not start after upgrade to build 7201
Please follow the procedures below to solve this problem
It is needed to make this change on the central as well on all the probes
Central :
1. Goto <Central Home>/conf/wrapper.conf file2. Remove the following two lines wrapper.java.additional.12=-XX:+HeapDumpOnOutOfMemoryError wrapper.java.additional.13=-XX:+UseConcMarkSweepGC
3.Save the file . 4.Now, restart the central service. Probe:1. Goto <Probe Home>/conf/wrapper.conf file2. Remove the following two lines wrapper.java.additional.12=-XX:+HeapDumpOnOutOfMemoryError wrapper.java.additional.13=-XX:+UseConcMarkSweepGC
3.Save the file . 4.Now, restart the probe service. 7100 -> 7201 upgrade issue
Upgrade flow: 6005 (or some other build less than 7100)-> 7100-> 7201
If you have upgraded directly to build 7201 from 7100 (applied 7201 ppm over 7100 build), then follow the steps given below to recover your old (7100) setup - Rename the AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1 folder present under <Central Home>/Patch directory.
- Rename the AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1.ppm file available under <Central Home>/Patch directory.
- Replace the attached specs.xml with the existing one available in the <Central Home>/Patch directory.
- Rename the patch folder under <Central Home>/desktopcentral directory.
- Replace the attached Product.conf file with the existing one available in the <Central Home>/desktopcentral/conf folder.
- Rename the patch folder under <Central Home>/supportcenter folder.
- Change the build number to 7100 in about.properties in the directory <Central Home>/html
- Now apply 7200 ppm , ensure central and all probe(s) upgraded to 7200,if not contact support team.
- After the Central and the probes have successfully upgraded to build 7200, then apply 7201 ppm.
- Open the file NmsProcessesBE.conf under <Central Home>/conf directory and search for string " AuthorizationEngineImpl true authorization_for_security_administration " and remove i.
7100 exe to 7201 or 7101 exe to 7201 upgrade issue
Upgrade flow: 7100 (fresh exe)-> 7201 or 7101 (fresh exe)-> 7201
Solution: - Rename the Patch folder available under <Central Home> directory.
- Rename the Patch folder present under <Central Home/desktopcentral> folder.
- Rename the Patch folder available under <Central Home/supportcenter> folder.
- Replace the attached Product.conf file with the existing one available in the <Central Home>/desktopcentral/conf folder.
- Change the build number to 7100/7101 in about.properties in the directory <Central Home>/html.
- Now apply 7200 ppm, ensure central and all probe(s) upgraded to 7200, if not contact support team.
- Then, apply 7201 ppm.
- Open the file NmsProcessesBE.conf under centralconf and search for "AuthorizationEngineImpl true authorization_for_security_administration" and remove it.
6005/7002/7003/7004/7005 build to 7201 upgrade issue
If you have tried to upgrade to 7201 build directly from 6005, 7002, 7003, 7004 or 7005, the update manager will throw some error messages like "Unexpected Error".
Solution: - Rename the folder AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1 in the directory <Central Home>/Patch.
- Now follow the correct procedure to install 7201ppm.
7101-> 7201 upgrade issue
Upgrade flow: 7000 (or some build less than 7101)-> 7101-> 7201
Solution: - Rename the AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1 folder present under <Central Home>/Patch directory.
- Rename the AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1.ppm file present under <Central Home>/Patch directory
- Remove 7201 related entries mentioned below from specs.xml file available under <Central Home>/Patch directory
a) Search for the string "AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" and remove the same.
b) Then, remove <VERSION Name="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Size="13865679" Date="20 October 2009 5:34 PM" Description="7201" PatchName="AdventNet_ManageEngine_OpManager_7_0_SP-2_0_1.ppm" DisplayName="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Type="SP" ContentType="Consolidated"><CONTEXT Name="CENTRAL"/></VERSION> - Rename the folder "ManageEngine_Desktop_Central-6.0.0-SP-2.23" under the directory <Central Home>/desktopcentral/Patch
- Remove below entries from the specs.xml under the directory <Central Home>/desktopcentral/Patch
a) Search for for the string "ManageEngine_Desktop_Central-6.0.0-SP-2.23" and remove it.
b) Remove the tag <VERSION ContentType="Consolidated" Date="20 October 2009 5:33 PM" Description="ManageEngine Desktop Central 6 - SP2 - Hotfix 21" DisplayName="ManageEngine_Desktop_Central-6.0.0-SP-2.23" Name="ManageEngine_Desktop_Central-6.0.0-SP-2.23" PatchName="DesktopCentral.ppm" Size="4961597" Type="SP"><CONTEXT Name="SERVER"/></VERSION> - Please save the attached Product.conf file under <Central Home>/desktopcentral/conf directory.
- Rename the folder "AdventNet_ManageEngine_SupportCenter_Plus-5.0.0-SP-3.2.8" under the directory <Central Home>/supportcenter/Patch
- Remove below entries from the specs.xml under the directory <Central Home>/supportcenter/Patch
a) Search for the string "AdventNet_ManageEngine_SupportCenter_Plus-5.0.0-SP-3.2.8" and remove it.
b) Remove the tag <VERSION ContentType="Consolidated" Date="20 October 2009 5:32 PM" Description="SUPPORTCENTER PATCH" DisplayName="AdventNet_ManageEngine_SupportCenter_Plus-5.0.0-SP-3.2.8" Name="AdventNet_ManageEngine_SupportCenter_Plus-5.0.0-SP-3.2.8" PatchName="HelpDesk.ppm" Size="450766" Type="SP"><CONTEXT Name="SUPPORTCENTER"/> - Change the build number to 7101 in about.properties in the directory <Central Home>/html
- Now apply 7200 ppm , ensure central and all probe(s) have upgraded to 7200. If not contact our support team.
- Now apply 7201 ppm.
- Open the file NmsProcessesBE.conf under <Central Home>/conf and search for "AuthorizationEngineImpl true authorization_for_security_administration" and remove it.
In Resource monitors report, CPU, Memory & Disk monitors are shown twice
Issue: When generating reports on resource monitors , the cpu , memory , disk monitors show up twice in the report for some devices .
Solution: Steps to be followed on the Probe server: - Connect to the database of the probe server that monitors the device.
- Execute the below query
delete from polleddata where (name='CPUUtilization' and policyname='Win-CPUUtilization' and oid='.1.3.6.1.2.1.25.3.3.1.2') or (name='MemoryUtilization' and policyname='Win-MemoryUtilization' and oid='.1.3.6.1.2.1.25.5.1.1.2') or (name='CPUUtilization' and policyname='Lin-CPUUtilization' and oid='.1.3.6.1.4.1.2021.11.9.0'); - Restart the Probe service once.
Steps to be followed on the Central server: You need to do the same thing on the central server as well
- Connect to the Central's database.
- Execute the below query
delete from polleddata where (name='CPUUtilization' and policyname='Win-CPUUtilization' and oid='.1.3.6.1.2.1.25.3.3.1.2') or (name='MemoryUtilization' and policyname='Win-MemoryUtilization' and oid='.1.3.6.1.2.1.25.5.1.1.2') or (name='CPUUtilization' and policyname='Lin-CPUUtilization' and oid='.1.3.6.1.4.1.2021.11.9.0'); - Restart the central service once.
Probe failing to start after upgrading the Central to 7200 & 7201
Issue: Probe fails to start after you have upgraded the Central (say from 7101) first to 7200 and then to 7201
Possible reasons: - There is an outage of the Probe during the upgrade.
- You would have applied 7201 ppm on the Central before the Probe has upgraded to 7200. When you are doing consecutive upgrades, always ensure whether all the Probes have upgraded. Then start applying the next ppm.
Steps to troubleshoot: - In the central server, open the specs.xml [Central Home>/Patch].
- Search for the following entry
<VERSION Name="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Size="13865679" Date="26 November 2009 11:41 AM" Description="7201" PatchName="AdventNet_ManageEngine_OpManager_7_0_SP-2_0_1.ppm" DisplayName="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Type="SP" ContentType="Consolidated"> - Now, replace the entry as follows:
<VERSION Name="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Size="13865679" Date="26 November 2009 11:41 AM" Description="7201" PatchName="AdventNet_ManageEngine_OpManager_7_0_SP-2_0_1.ppm" DisplayName="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Type="SP" ContentType="Non-Consolidated"> - In the probe side, rename the AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1 folder [<Probe Home>/Patch].
- Rename the AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1.ppm [<Probe Home>/Patch].
- In the probe side, open the specs.xml file [<Probe Home>/Patch] and remove 7201 related entries as mentioned below. If the file is not there, please skip this step.
(a) Search for the string "AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" and remove the same.
(b) Then, remove <VERSION Name="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Size="9180352" Date="26 November 2009 12:13 PM" Description="7201" PatchName="AdventNet_ManageEngine_OpManager_7_0_SP-2_0_1.ppm" DisplayName="AdventNet_ManageEngine_OpManager-7.0-SP-2.0.1" Type="SP" ContentType="Consolidated"><CONTEXT Name="PROBE"/></VERSION> - Open the about.properties file [<Probe Home>/html] and change the build number to which the user had already been in.
- Now, restart the probe. The PPMs will be automatically applied and the Probe will be upgraded to 7201.
Agents of size 0KB created Issue : When creating desktop management agents agents of size 0KB are created Procedures to solve the problem of 0kb agents getting created - Connect to the database of the Central server. Procedures to connect to the database are available in the following link
http://help.mspcenterplus.com/connecting-to-MySQL-DB.html - Execute the below query the mysql prompt (mysql>)
delete from resource where DOMAIN_NETBIOS_NAME=";
Eg.:mysql>delete from resource where DOMAIN_NETBIOS_NAME="; - Download the attached desktopcentralagent.zip file to the Central server
- Extract the zip file on the Central server under the following path
<Central Home>desktopcentralwebappsDesktopCentralagent - Recreate the agent for the specific customer.
Procedures to remove the database entries of a device already added ---------->Remove DB Entries ---->(Build 7100 and above) - Connect to the probe database.
- Execute the following queries
- Query with displayname:
Syntax: select * from managedobject where displayname like '%<name (or) ip-address of the device>%';
Example: select * from managedobject where displayname like '%shgfvoip.novusint.com.novusint_hq%'; (or) select * from managedobject where displayname like '%2.168.10.4%'; - Query with name:
Syntax: select * from managedobject where name like '%<name (or) ip-address of the device>%';
Example: select * from managedobject where name like '%shgfvoip.novusint.com.novusint_hq%'; (or) select * from managedobject where name like '%2.168.10.4%';
Note : Try all the four combinations, you might find an entry for any of the above queries. - If you don't find any entries in the Probe database, execute the above steps in Central database.
- Note down the exact name of the device and the moid value obtained from the above query (This will be used as arguments for the RemoveDBEntries.bat script)
- Download the attached RemoveDBLatest.zip file from the link below and extract it to Central and Probe home folders.
- Rename the "RemoveDBLatest" folder available under Probe home directory [\probe] to "RemoveDBEntries".
- In Probe server, from the command prompt execute removedbentries.bat [\probe\RemoveDBEntries].
Syntax: /program files/adventnet/me/probe/RemoveDBEntries>removedbentries.bat <name of the device> <moid value>
Example: /program files/adventnet/me/probe/RemoveDBEntries>removedbentries.bat shgfvoip.novusint.com.novusint 111254 - Rename the "RemoveDBLatest" folder available under Central home directory [\central] to "RemoveDBEntries".
- In Central server, from the command prompt execute removedbentries.bat [\central\RemoveDBEntries].
Syntax: /program files/adventnet/me/central/RemoveDBEntries>removedbentries.bat <name of the device> <moid value> Example: /program files/adventnet/me/Central/RemoveDBEntries>removedbentries.bat shgfvoip.novusint.com.novusint 111254 - Restart both Central and Probe services for the changes to take effect.
- Add the device again from the Probe web client.
Procedures to run Mysqlcheck (Advanced database repair)
Sometimes the DB might get corrupted and CentralProbe might not start. We usually use repairdb tool - which is invoking myisamchk. We can also make use of mysqlcheck which has more advanced switch options to optimize the DB.
Follow the procedures below to run mysqlcheck
Running Mysqlcheck on central server :
1.Please download this mysqlcheck.zip file and extract this into the centralmysqlin folder 2.Open a command window on the central server and navigate to Program filesadventnetmecentralmysqlinmysqlcheckin 3.Execute the command mysqlcheck.exe -f -r -u root -P 23306 centraldb Eg; Program filesadventnetmeprobemysqlinmysqlcheckin>mysqlcheck.exe -f -r -u root -P 23306 dmsdb
4.Let the mysqlcheck complete
Running Mysqlcheck on probe server :
1.Extract the downloaded mysqlcheck.zip to the probemysqlin folder 2.Open a command window on the probe server and navigate to Program filesadventnetmeprobemysqlinmysqlcheckin 3.Execute the command mysqlcheck.exe -f -r -u root -P 33306 dmsdb Eg; Program filesadventnetmeprobemysqlinmysqlcheckin>mysqlcheck.exe -f -r -u root -P 33306 dmsdb
4.Let the mysqlcheck complete
Procedures to install SSL Certificates from Network Solutions
Central Server: Following commands are to be executed from the command prompt in the directory <Central_Home>jrein (Central_Home will be commonly Program FilesAdventNetMECentral)
Step 1 :
C:AdventNetMECentraljrein>keytool.exe -keysize 2048 -genkey -alias CentralSSL -keyalg RSA -keystore server.keystore
Enter keystore password: (enter password, for example : storepw) What is your first and last name? [Unknown]: (enter the domainname with which you want to connect , for example : www.mspcenterplus.com)
What is the name of your organizational unit? [Unknown]: (enter the name of your organization, for example : MSPCenterPlus)
What is the name of your organization? [Unknown]: (enter the name of your organization, for example : AdventNet or MSPCenterPlus)
What is the name of your City or Locality? [Unknown]: (enter the name of the city, for example : Austin, New York, Hounslow, Hammersmith etc..)
What is the name of your State or Province? [Unknown]: (enter the name of state the above city belongs to, for example : Texas, New York, London etc..)
What is the two-letter country code for this unit? [Unknown]: (enter the two letter country code for the state, for example : TX, NY, LN etc..) Is CN=www.mspcenterplus.com, OU=MSPCenterPlus, O=AdventNet, L=Austin, ST=Texas, C=TX correct? [no]: Yes
Enter key password for <CentralSSL> (RETURN if same as keystore password): storepw
Step 2 :
C:AdventNetMECentraljrein>keytool.exe -certreq -keyalg RSA -alias CentralSSL -file certreq.csr -keystore server.keystore (Creates the certreq.csr , which is to submitted to the CA for obtaining certificates) Enter keystore password: storepw
(Take a backup of the server.keystore AND certreq.csr , located in the path <Central_Home>jrein for re-use , if you need to startover again from beginning due to some error in the upcoming steps)
Step 3 :
Use the Certificate Service Request file, as in step 2, certreq.csr file, to generate the SSL Certificates for your domain ( in this example, it is www.mspcenterplus.com )
Further down, the steps listed are those associated with Network Solutions. These steps differ based on the SSL Provider you choose.
Step 4 :
Installing Root certifcate First, import the root certificate (called AddTrustExternalCARoot.crt), using the following command:
C:AdventNetMECentraljrein>keytool -import -trustcacerts -alias root -file c:certAddTrustExternalCARoot.crt -keystore server.keystore {c:cert is the path where the AddTrustExternalCARoot.crt file is present} Enter keystore password: storepw
Certificate was added to keystore
Step 5 :
Installing Intermediate certifcates Next, import the first intermediate certificate (called UTNAddTrustServer_CA.crt), using the following command:
C:AdventNetMECentraljrein>keytool -import -trustcacerts -alias UTNAddTrustServer_CA -file UTNAddTrustServer_CA.crt -keystore server.keystore Enter keystore password: storepw
Certificate was added to keystore
Repeat this command with any other intermediates certificates you received. (NetworkSolutions_CA.crt) C:AdventNetMECentraljrein>keytool -import -trustcacerts -alias NetworkSolutions_CA -file NetworkSolutions_CA.crt -keystore server.keystore Certificate was added to keystore
Step 6 :
Installing certificate specific to your domain Finally, import the site certificate (the file with your domain in the filename), using the following command: C:AdventNetMECentraljrein>keytool -import -alias CentralSSL -keystore server.keystore -trustcacerts -file NMS.MONITORING.COM.crt
Step:7
C:AdventNetMECentraljrein>keytool -export -keystore server.keystore -alias CentralSSL -storepass storepw -file e: emp.cer (e: emp.cer is the path where the keystore is exported temporarily)
Certificate stored in file <e: emp.cer>
Step :8
C:AdventNetMECentraljrein>keytool -import -keystore https.truststore -alias CentralSSL -file e: emp.cer -storepass storepw (Imports the keystore to the file https.truststore)
If you get an error java.lang.exception , then rename the https.truststore file present in the path C:AdventNetMECentraljrein> to https.truststore_old and then redo Step:9
Step : 9
Copy the https.truststore file in the <Central_Home>jrein directory to the <Central_Home>confprobedefaultToNewProbesconf and <Central_Home>conf directories.
Step :10
Copy the server.keystore file in the <Central_Home>jrein directory to the <Central_Home> omcatconf directory.
Step 11:
Restart the central server.
Probe Server:
1. Copy the https.truststore file from <Central_Home>conf directory to <Probe_Home>conf directory. 2. Execute the batch file in the <Probe_Home>in directory with the command " ssl_gen.bat -f ".
Probe not starting due to Socket Exception. No buffer space available.
Exception received in the Probe Exception while fetching the customername from ManagedObject with name: 10.10.10.10.smartims_nj Communications link failure due to underlying exception:
** BEGIN NESTED EXCEPTION **
java.net.SocketException MESSAGE: No buffer space available (maximum connections reached?): recv failed
STACKTRACE:
java.net.SocketException: No buffer space available (maximum connections reached?): recv failed at java.net.SocketInputStream.socketRead0(Native Method) at java.net.SocketInputStream.read(Unknown Source) at com.mysql.jdbc.util.ReadAheadInputStream.fill(ReadAheadInputStream.java:113) at com.mysql.jdbc.util.ReadAheadInputStream.readFromUnderlyingStreamIfNecessary (ReadAheadInputStream.java:160) | Steps to troubleshoot: - Execute the command "netstat" in command prompt and see if there are large number of connections in TIME_WAIT mode...
- If true, then follow the instructions provided in the Microsoft knowledge base link given below:
http://support.microsoft.com/default.aspx?scid=kb;EN-US;196271 The steps given below are the same that is available in the above mentioned Microsoft knowledge base link: - Start Registry Editor.
- Locate the following subkey in the registry, and then click Parameters:
HKEY_LOCAL_MACHINESYSTEMCurrentControlSetServicesTcpipParameters - On the Edit menu, click New, and then add the following registry entry:
Value Name: MaxUserPort Value Type: DWORD Value data: 65534 Valid Range: 5000-65534 (decimal) Default: 0x1388 (5000 decimal) Description: This parameter controls the maximum port number that is used when a program requests any available user port from the system. Typically, ephemeral (short-lived) ports are allocated between the values of 1024 and 5000 inclusive. After the release of security bulletin MS08-037, the behavior of Windows Server 2003 was changed to more closely match that of Windows Server 2008 and Windows Vista. For more information about Microsoft security bulletin MS08-037, click the following article numbers to view the articles in the Microsoft Knowledge Base:
951746 (http://support.microsoft.com/kb/951746/ ) MS08-037: Description of the security update for DNS in Windows Server 2008, in Windows Server 2003, and in Windows 2000 Server (DNS server-side): July 8, 2008 951748 (http://support.microsoft.com/kb/951748/ ) MS08-037: Description of the security update for DNS in Windows Server 2003, in Windows XP, and in Windows 2000 Server (client side): July 8, 2008 953230 (http://support.microsoft.com/kb/953230/ ) MS08-037: Vulnerabilities in DNS could allow spoofing - Exit Registry Editor, and then restart the computer.
Note: An additional TCPTimedWaitDelay registry parameter determines how long a closed port waits until the closed port can be reused. | Probes not upgrading to 7202 ppm (only for 7200 ppm upgrade) Probes that have proxy server settings enabled fail to upgrade to 7202 build.
Error seen in updatemanagerlog.txt in <probe home>/logs/ 15:42:58:590 Invoking UpdateManager in CMD mode 15:42:58:590 UpdateManager ProductName:AdventNet ManageEngine OpManager 15:42:58:590 UpdateManager ProductVersion:7.0 15:42:58:590 UpdateManager ProductContext:PROBE 15:42:58:731
15:42:58:731 Patch Installation Started 15:42:58:731 The ppm file path:C:PROGRA~1ADVENT~1ME probePatchAdventNet_ManageEngine_OpManager_7_0_SP-2_0_2.ppm 15:42:58:731 The Patch Version: AdventNet_ManageEngine_OpManager-7.0-SP-2.0.2 15:42:58:731 Context NamePROBE 15:42:58:793 Pre Invocation in progress 15:42:58:793 Executing class: com/adventnet/me/opmanager/operations/server/OpmPreInvocation.class java.lang.reflect.InvocationTargetException at sun.reflect.NativeMethodAccessorImpl.invoke0 (Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke (Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke (Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at com.adventnet.tools.update.installer. Unzipper.contextPreInstallation(Unzipper.java:279) at com.adventnet.tools.update.installer. Unzipper.invokePreInstallationClasses(Unzipper.java:132) at com.adventnet.tools.update.installer. ApplyPatch.installPatch(ApplyPatch.java:272) at com.adventnet.tools.update.installer. ApplyPatch.run(ApplyPatch.java:222) at java.lang.Thread.run(Unknown Source) Caused by: java.lang.NoClassDefFoundError: com/adventnet/me/opmanager/operations/server/OpmPreInvocation$ProxyAuthentication at com.adventnet.me.opmanager.operations.server. OpmPreInvocation.setProxyForConection(OpmPreInvocation.java:663) at com.adventnet.me.opmanager.operations.server. OpmPreInvocation.checkURL(OpmPreInvocation.java:543) at com.adventnet.me.opmanager.operations.server. OpmPreInvocation.install(OpmPreInvocation.java:118) ... 9 more
| Steps to troubleshoot: - Extract the attached zip in probe home directory.
- Open a command window.
- Go to <Probe Home>/bin/
- Run the command UpdateManager.bat
ie [<probe home>/bin/UpdateManager.bat] - Please browse the ppm 'AdventNet_ManageEngine_OpManager_7_0_SP-2_0_2.ppm' available in '<probe home>/Patch/' folder.
- Install this patch.
- Once installation is completed, start the probe.
Issue in adding file monitor If you find any issue when adding file monitor, then - Check out for the exception "Unknown column 'File_Monitor_File_Size.SIZECONDITION" in stderr.txt [<central/probe> home/logs].
 - Check for the column names SIZECONDITION, AGECONDITION and NOCONDITION in file_monitor_file_size, file_monitor_file_age and file_monitor_no_of_files tables respectively, using Submit Query. If the column name is 'CONDITION', follow the troubleshooting steps to change the column name. Check the column names in both Central and Probe.
Steps to troubleshoot: From Submit Query, change the column name of the above said tables using the following queries: - ALTER TABLE file_monitor_file_size CHANGE `CONDITION` `SIZECONDITION` INTEGER;
- ALTER TABLE file_monitor_file_age CHANGE `CONDITION` `AGECONDITION` INTEGER;
- ALTER TABLE file_monitor_no_of_files CHANGE `CONDITION` `NOCONDITION` INTEGER;
Daylight Savings
Follow the steps below to adjust the mspcenter time for changes in daylight savings Note: repeat the same for all probes.
- Update your OS for daylight savings. Refer this URL http://support.microsoft.com/gp/cp_dst
- Download the dst patch for JAVA from SUN website. Refer this link
- Stop MSPCenter
- Extract the zip from sun website and place the tzupdater.jar in the central/lib folder.
- Download the attached dstupdater.bat file and place it under /central/bin folder. Rename the attached .txt files to .sh or .bat
- Execute the dstupdater.bat from the /central/bin folder.
- Start MSPCenter.
Some common log prints and their meanings. Log File
| Log Print | Reason | Steps to troubleshoot | cantcreatetable.txt
|
| During every start up Probe/Central creates some tables. This error occurs when it cannot contact the database to create the tables.
| Follow the troubleshooting steps provided for DB Server failed error.
| classnotfound.txt
| Unable to load cryptix.jce.provider.Cryptix Cryptojava.lang.ClassNot FoundException: cryptix.jce.provider. CryptixCrypto
| Harmless.
| Can be ignored. | connectionlost.txt
| Connection lost with the Central Server[mgt-tchx-opman.srv.redstone-isp.net:443] at Mon Jul 20 09:00:08 BST 2009
| A. Central Server's NAT/Public IP address may have changed B. Could be a SSL issue C. Network/Internet/Firewall issue
Ensure whether there the probe is communicating with the central: 1. telnet to the central server from the probe server using the command telnet ip <central's ip address> 2. If the telnet connection is established, then the probe is communicating with the Central. If not, then there is a failure in the connection.
or
From the Probe server, open the central web client. If you could open, then the Probe is communicating with the Central and vice versa.
| A: In the probe Open the NOCServer Details.xml file [probeconf]. Then change the NOCServerName field with the new Central's NAT/Public IP. Now restart the Probe service. Also follow the steps given in "B" [SSL issue].
B: Click here to troubleshoot if you have changed the Central's NAT/Public IP
C: Verify your internet, network & firewall settings
| connection timedout.txt | java.io.IOException: Connection timed out: connect | Harmless print.
| Can be ignored. | dbserverfailed.txt
| DBServer Faied
| A. Some table could have been corrupted B. Could be due to pdlastvalues issue C. Database port occupied by some other application
| A: Follow the troubleshooting steps provided for tablecorrupt.txt B: Click here to know the steps to troubleshoot. C: Change DB port. Change in port.properties file
| | dmsiswaiting.txt | DMS is waiting for registration from the Central Server | Probe could not able to communicate with the Central due to A. Central IP could be wrongly mentioned in the NOCServerDetails.xml file in the probe under conf directory B. Network/Internet issue C. Firewall port could be blocked D. Could be a SSL issue
| Follow the trouble shooting steps A and B of connectionlost.txt
| dmsalreadyexists.txt
| DMS already exists
| A. This error occurs when you use the same name and key of a deleted Probe to a new Probe. B. When you re-initialize the database of the Probe [probein reinitialize_dms.bat].
| Create a new Probe with a unique name.
| exceptionin startid.txt
| Exception while setting the startID
|
| Contact us.
| gracefullyshutting downopmanager.txt
| Failed to establish connection with web server. Gracefully shutting down OpManager
| A. This error occurs when the Central/Probe fails to connect with the Apache web server. B. Java.exe or some other application could have occupied the port 443. C. Could be due to the SSL issue
| A: 1. Verify whether the local IP or Name of the Central is mentioned correctly against the APACHE_SERVER _NAME field in the serverparameters .conf file [centralconf]. If not then correct it accordingly. If the error occurs in Probe, then check whether the Probe's local IP or Name is mentioned in serverparameters. conf file [probeconf]
B: 1. Terminate java.exe application and try to start the Central/Probe. 2. If still the same error is received, then Change the Web server Port of the Central/Probe. C: 1. Generate SSL Certificate using ssl_gen.bat [centralin] on the Central Server and restart the Central Server 2. Copy the https.truststore file [centralconf] and replace it with the one in the Probe [probeconf]. 3. Now Restart the Probe.
If the problem still exists, then contact us.
| interrupt.txt
| Interrupt signal received shutting down opmanager
| Some one has terminated the Central service
| Start the Central service
| | info.txt | Central build number <build number> is not compatible with Probe build number <build number>. Hence shutting down the probe | There might be a mismatch in build number between the Central and the Probe.
| 1. Check the build number of the Probe and the Central. 2. Upgrade the Probe to the Central's build number.
| lastfileid.txt
| The file lastFileID.txt is not present
| The lastFileID.txt is a text file which contains the ID of the last file that is sent to the Central for data processing. This error occurs when this text file gets corrupted.
| Please contact us.
| mysqlerrfile.txt
| 090727 19:24:55 [Warning] Aborted connection 23 to db: 'centraldb' user: 'root' host: 'localhost' (Got an error reading communication packets)
| Harmless print.
| Can be ignored. | outofmemory.txt
| OutOfMemoryError: Java heap space
| This could be due to insufficient hardware resources
| 1. Visit our System Requirements page and check whether you have configured enough resources. 2. Go through the Java heap table to know the RAM size and the Heap Space it can handle. Also it provides the steps to increase the Java Heap size.
| | pdlastvalues.txt | Exception while getting MetaDataInfo : Incorrect file format 'pdlastvalues3'
java.sql.SQLException: Incorrect file format 'pdlastvalues3'
Could be warm start pdLastValues already exist - Table 'pdlastvalues2' already exists |
| Click here to know the steps to troubleshoot.
| probeconnected.txt
| <Probe name> Probe has connected with properties
| Harmless print.
| Can be ignored. | problemininitializing module.txt | PROBLEM IN INITIALIZING MODULE class com.adventnet.nms.startnms. NmsMainFE | Harmless print.
| Can be ignored. | sslexception.txt
| Exception occured while checking ssl communication sun.security.validator. ValidatorException: PKIX path building failed: sun.security.provider .certpath.SunCertPath BuilderException: unable to find valid certification path to requested target | This occurs when you have any SSL certificate issue. This is common in the Probe side.
| Copy the https.truststore file [centralconf] and replace it with the existing file in the Probe [probeconf].
| start-stop.txt
| Wrapper Stopped STATUS | wrapper | 2009/07/29 16:57:54 |
| Central or Probe service has been stopped manually.
| Start the respective service using StartOpManger Server.bat [Central or Probe in]
| | statefilecorrupt.txt | State File corrupted DataID.dmp | Central Process the files sent by the Probes one by one. If suddenly it receives a huge load of files, then it may miss a file to process. If such thing happens, then this error occurs.
| Move the DataID.dmp file [centralstatecommunicationlowpriority or probestatecommunicationlowpriority] to some other location and restart the Probe service.
| tablealready exists.txt
| Table Already exists : Table 'statsdata_hourly8_2009' already exists
Table Already Exists . Assuming Warm Start of server
| Harmless print.
| Can be ignored. | tablecorrupt.txt
| Exception while getting MetaDataInfo : Can't find file: 'event' (errno: 2)
java.sql.SQLException: Can't find file: 'event' (errno: 2)
Debug Message is Can't find file: 'ManagedObject' (errno: 2)
com.adventnet.nms.store. NmsStorageException: Can't find file: 'ManagedObject' (errno: 2)
| Some tables might have got corrupted.
| 1. Stop the Central or Probe Service. 2. Execute ReparitDB.bat [centralin or probein]. 3. Start the Central or Probe Service.
| unabletoconnect tocentral.txt
| Unable to connect to UpdateManagerServer in <device name/ip> The SmartUpdate option in server may be disabled in server side
| This occurs when the Central server is down or the connectivity between the Probe and the Central is down.
| Verify the Central Server and the Connectivity between the Probe and the Central.
| unabletostart MySQL.txt
| Unable to start Mysql daemon
| MySQL service could not able start at the Central or Probe
| Start the respective service using StartMySQL.bat [Central or Probe in]
| 0
Taking Thread dumpSteps to take thread dump - Download stack trace from http://www.adaptj.com/main/stacktrace
- Install stracktrace.
- Open stracktrace.
- Browse the java process and take threaddump.
- Take threaddump for all java processes.
- put it in a word doc and email to support@mspcenterplus.com Or use the email option in the tool.
Note: If you don't have Java installed, then download Java and install it. While intalling stacktracke, it asks for java.exe and javaw.exe files. You can browse to the installed Java/bin directory. Problem with SMS notification - First clear the entries in the table sms_out by following the procedures below
- Connect to central server's database.
- Execute the following query
delete from sms_out: - Ensure whether you have entered the correct baud rate in the smsserver.conf.
- Open the smsserver.conf file [central/conf].
- Look for the entry "serial.baud=" and make sure it has the correct baud rate settings configured (Baud rate settings configured here should match with the rate supported by the sms modem).
- If the baud rate is mentioned wrongly, then correct it.
- Take a backup of DataManagement.xml file [central/conf].
- Open this file and look for the following entries
<DATA_CLEANUP id="CLEANUP_SMS_DATA" executeInterval="1" executeIntervalUnit="DAYS" className="com.adventnet.me.opmanager.server.dataarchiver.DefaultDataCleanupIfcImpl"> <PROPERTY name="TABLE_LIST" value="SMS_OUT"/> <PROPERTY name="TIME_FIELD" value="DISPATCH_DATE"/> <PROPERTY name="CLEANUP_DATA_OLDER_THAN" value="7"/> <PROPERTY name="CLEANUP_DATA_OLDER_THAN_UNIT" value="DAYS"/> </DATA_CLEANUP> - Replace the line
<PROPERTY name="CLEANUP_DATA_OLDER_THAN" value="7"/> with <PROPERTY name="CLEANUP_DATA_OLDER_THAN" value="1"/> After the changes the file should look like the following <DATA_CLEANUP id="CLEANUP_SMS_DATA" executeInterval="1" executeIntervalUnit="DAYS" className="com.adventnet.me.opmanager.server.dataarchiver.DefaultDataCleanupIfcImpl"> <PROPERTY name="TABLE_LIST" value="SMS_OUT"/> <PROPERTY name="TIME_FIELD" value="DISPATCH_DATE"/> <PROPERTY name="CLEANUP_DATA_OLDER_THAN" value="1"/> <PROPERTY name="CLEANUP_DATA_OLDER_THAN_UNIT" value="DAYS"/> </DATA_CLEANUP> - Save the changes and restart the central service once.
Communication with the Central server down since <timestamp> - If this happens in a single probe, follow the steps provided in http://help.mspcenterplus.com/support.html#5.
- If this happens in all the probes, do the following steps:
- Check whether you have installed a new SSL certificate
Data not shown for all the interfaces/snmp monitorIf none of the interfaces/snmp monitors doesn't show any data, follow the steps given below to troubleshoot: A Check whether SNMP is enabled on the end machine - Go to the device snapshot page.
- Check whether a blue star image is available near the title of the snapshot page. The blue star indicates that the device is discovered via SNMP. If you cannot find the blue star, discover the device as a snmp device.
 B Steps to discover the device as a SNMP device - Click on the Passwords link available in the device snapshot page.
 - Check whether you have configured the snmp read credentials correctly. If not, please correct it.
- Now rediscover the device. In the snapshot page, mouse over Actions tab and select Rediscover Now.
- Now try Test monitor and check whether the data is getting collected.
C Check output for general snmp queries via MIB browser - Identify whether the host name or ip address is assigned as the DNS name for that device
- From Central or Probe web client and go to submit query page.
- Enter the following command in the query box.
select DNSNAME, OID from polleddata where agent like "<device-name or ip address>"
eg: select DNSNAME, OID from polleddata where agent like "%opman%"
 - Check whether host name or ip address is assigned as the DNS name
- Open a command window on the probe server.
- Navigate to the path <probe home>/bin.
- Execute the command mibbrowser.bat.[Eg. C:/Program Files/Adventnet/ME/probe/bin]
- A mib-browser window opens up.
 [click on the image to enlarge] - Type the ip-address or host name (whichever is associated as the DNS name) of the device in the hostname box (ip-address of the device that is being queried).
- Type the correct SNMP read community string(as configured on the device being queried) in the community box.
- Load RFC1213 MIB and navigate to sysDescr OID and click on get SNMP variable button in the MIB-Browser to test the response of the OID.
If you could see the response proceed to next step, else correct this issue and try the steps. D Check output for interface / snmp monitor specific queries via MIB browser - Open the MIB browser on the probe server.
- Type the ip-address or host name (whichever is associated as the DNS name) of the device in the hostname box (ip-address of the device that is being queried).
- Type the correct SNMP community string(as configured on the device being queried) in the community box.
- Enter the oid of interface or snmp monitor you want to monitor [To get the oid, go to the device snapshot page, click 'Edit' against that monitor].
 - Click on get SNMP variable button in the MIB-Browser to test the response of the OID.
- If your are troubleshooting for interfaces, then cross check the OID response with interfaces list in the web client. The index IDs should match. If there is a mismatch, interfaces cannot show data. In that case, rediscover the interfaces (delete the interfaces and click on rediscover discover button).
 If nothing is shown in the MIB browser, then it is an issue with the SNMP in that device. Contact the device vendor. com.mysql.jdbc.CommunicationsException error If the latest stderr.txt file [<Central home>\logs] has the following error,
| com.mysql.jdbc.CommunicationsException: The driver was unable to create a connection due to an inability to establish the client portion of a socket.
This is usually caused by a limit on the number of sockets imposed by the operating system. This limit is usually configurable.
For Unix-based platforms, see the manual page for the 'ulimit' command. Kernel or system reconfiguration may also be required.
For Windows-based platforms, see Microsoft Knowledge Base Article 196271 (Q196271) | troubleshoot using the steps given below
Reason for this error: This error occurs due to OS level restriction on the number of ports that can be opened for socket connections from a particular computer
Steps to troubleshoot:
- Do netstat - an and see if there are large number of connections in TIME_WAIT mode.
- If true, then do the following
http://support.microsoft.com/default.aspx?scid=kb;EN-US;196271
The default maximum number of ephemeral TCP ports is 5000 in the products that are included in the "Applies to" section. A new parameter has been added in these products. To increase the maximum number of ephemeral ports, follow these steps: - Start Registry Editor.
- Locate the following subkey in the registry, and then click Parameters:
HKEY_LOCAL_MACHINE\SYSTEM\CurrentControlSet\Services\Tcpip\Parameters - On the Edit menu, click New, and then add the following registry entry:
Value Name: MaxUserPort Value Type: DWORD Value data: 65534 Valid Range: 5000-65534 (decimal) Default: 0x1388 (5000 decimal) Description: This parameter controls the maximum port number that is used when a program requests any available user port from the system. Typically, ephemeral (short-lived) ports are allocated between the values of 1024 and 5000 inclusive. After the release of security bulletin MS08-037, the behavior of Windows Server 2003 was changed to more closely match that of Windows Server 2008 and Windows Vista. For more information about Microsoft security bulletin MS08-037, click the following article numbers to view the articles in the Microsoft Knowledge Base: - Exit Registry Editor, and then restart the computer.
Note An additional TCPTimedWaitDelay registry parameter determines how long a closed port waits until the closed port can be reused. Troubleshooting CLI MonitorsIf the CLI monitors doesn't show any data, - Ensure whether you have configured the correct CLI credentials
- If you have configured it correctly, do test monitor
- If that doesn't work, copy the command in the test monitor window and execute it in the command prompt
A) Ensure whether you have configured the correct CLI credentials- From the probe machine, open the command prompt and login to telnet.
- Telnet the end machine using the following command
telnet <machine name>
- A login prompt is shown. Enter the login ID
login:
- A password prompt is shown. Enter the password
password: - You are now connected to the machine and receive a command prompt like
[user@machinename ~]$ - The last character (highlighted in 'Red' color :, :, $) you got when connected to the machine using telnet are the credentials for that machine. Now, go to the device snapshot page and check whether the credentials are provided correctly.
- In the device snapshot page, click on Passwords link.
- Ensure whether the characters for login prompt, password prompt and command prompt that you received in the command prompt matches with the one entered in the web client
Command Prompt $ Login Prompt : Password Prompt :

- If not, then correct the login prompt, password prompt and command prompt values.
- Also ensure whether you have configured User Name, Password and Connection Protocol correctly.
Now proceed to step B B) Do Test Monitor- From the device snapshot page, go to the particular CLI monitor which is not showing value.
- Click on Test Monitor button.
- Check whether you get the output.

- If not, proceed to step C.
C) Verify the command in telnet- Copy the command available against "Command" in Test Monitor Popup
- From the Probe machine, execute the command after logging into telnet
[user@machinename ~]$ /bin/df -m | awk '{x += $2} { y += $3 } { z += $4 } END { print x,y,z }' - Check if you get the output here.
 - If you get the value here and not in MSP Center Plus web clicent, then send us
- the screen shot of the above result
- logs from probe after doing a test monitor
- screenshot of the test monitor popup
- If you don't get the output here, it is problem with the machine. Please contact the vendor.
Error in downloading client from BEThis error 'Error in downloading client from BE' occurs when - You try to access the product via the webclient even before the product has started completely [or]
- Database tables get corrupted
Steps to troubleshoot:- Stop the central service and terminate the following processes (if they are running) in the task manager
- Java.exe
- mysqld-nt.exe
- Wrapper.exe
- Run 'RepairDB.bat' [<central-home>\bin] and then try to start the central service
- If the above procedure didn't work, Please follow the procedures in the link below to run mysqlcheck on the central installation first and then try to start the central http://support.opmanager.com/sd/AddSolution.sd?solID=29102
- If it still doesn't work, the issue may be due to pdlastvalues issues. Please follow the procedures from the link below http://help.mspcenterplus.com/pdlastvalues.html
- Again Check for any mysql / java process running in taskmanager. Kill them and then try to start the central service.
NTLM URL monitor domainname null issueSome URLs requires NTLM Authentication to access it from a remote machine. When these types of urls are to be monitored, they need the hostdomainname of probe machine as input. MSP Center Plus has problems in getting hostdomain name for Windows 7, Windows 2008, Windows 2008 R2, Windows Vista and throws an error like " Host Unavailable" in UI. Error: Error occured while trying to monitor the NTLM Authenticated urls: 8007000e - Not enough storage is available to complete this operation. : While getting WMI data from RS-DC for SELECT Domain FROM Win32_ComputerSystem java.lang.NullPointerException [13 Aug 2010 07:30:01:906] at com.adventnet.me.opmanager.server.HTTPClient.NTUtil. buildRequest(NTUtil.java:254) [13 Aug 2010 07:30:01:906] at com.adventnet.me.opmanager.server.HTTPClient.NTLMAuthorization Handler.getAuthorization (NTLMAuthorizationHandler.java:132) [13 Aug 2010 07:30:01:906] at HTTPClient.AuthorizationInfo.queryAuthHandler (AuthorizationInfo.java:335) [13 Aug 2010 07:30:01:906] at HTTPClient.AuthorizationModule.setAuthHeaders (AuthorizationModule.java:572) [13 Aug 2010 07:30:01:906] at HTTPClient.AuthorizationModule.handle_auth_challenge (AuthorizationModule.java:433) [13 Aug 2010 07:30:01:906] at HTTPClient.AuthorizationModule.responsePhase2Handler (AuthorizationModule.java:362) [13 Aug 2010 07:30:01:906] at HTTPClient.HTTPResponse.handleResponse (HTTPResponse.java:736) [13 Aug 2010 07:30:01:906] at HTTPClient.HTTPResponse.toString (HTTPResponse.java:639) [13 Aug 2010 07:30:01:906] at java.lang.String.valueOf(Unknown Source) [13 Aug 2010 07:30:01:906] at java.lang.StringBuilder.append(Unknown Source) [13 Aug 2010 07:30:01:906] at com.adventnet.me.opmanager.urlmonitor.UrlDataHandler.checkUrlData (UrlDataHandler.java:607) [13 Aug 2010 07:30:01:906] at com.adventnet.me.opmanager.urlmonitor.UrlDataUtils.checkUrl (UrlDataUtils.java:281) [13 Aug 2010 07:30:01:907] at com.adventnet.opmee.operation.UrlSyncOperation.executeProbe (UrlSyncOperation.java:59) [13 Aug 2010 07:30:01:907] at com.adventnet.opmee.operation.AbstractOperation.execute (AbstractOperation.java:58) [13 Aug 2010 07:30:01:907] at com.adventnet.opmee.operation.RemoteExecutor$SyncExecutor.run (RemoteExecutor.java:57) [13 Aug 2010 07:30:01:907] at com.adventnet.management.scheduler.WorkerThread.run (WorkerThread.java:71) | Steps to troubleshoot:- Open wrapper.conf available under <probe home>/conf foloder
- Add the below line at the end of the file
wrapper.java.additional.13=-DHTTPClient.hostDomain=zohocorpin.com
- Change the "zohocorpin.com" to the correct domain name of the probe.
- Replace the highlighted 13 with the next incremented integer for 'wrapper.java.additional.' series i.e., if the series "wrapper.java.additional." ends with 12, then we have to add the entry 'wrapper.java.additional.' with the number 13
- Save the file
- Now restart probe
Device Availability Graph showing incorrect dataError: Availability graph showing incorrect values for a specific period or days. Steps to troubleshoot:Fix 1: Stop this problem from continuing in future http://help.mspcenterplus.com/support.html#26Fix 2: Manually update the database for the days (example: 2011-02-10 to 2011-02-11) that is showing the wrong data. Execute the following commands (in bold) in the SubmitQuery. - select moid,name,displayname from managedobject where displayname like '%<device-name>%';
eg: select moid,name,displayname from managedobject where displayname like '%opman%';

- select * from metatable where LOOKUPTABLENAME like "elementavailabilityhourly"

- The above query will give you a list of rows. Choose the table that matches with the above duration.
For example if the problem occurred from Feb10 then look for a table with ARCHIVETABLENAME was 2011_02_10_X. Sometimes there might be multiple tables like this. In that case do the following for each table.- select * from elementavailabilityhourly2011_02_10_16 where elementid=2162
(click on the image to enlarge)
- update elementavailabilityhourly2011_02_10_16 set elementdown=0, uptime=3600 where elementid = 2162

- select * from elementavailabilityhourly2011_02_10_16 where elementid=2162
(click on the image to enlarge)
- select * from metatable where LOOKUPTABLENAME like "elementavailabilitydaily"
- execute the same three steps (i, ii, & iii) as you did for elementavailabilityhourly in the step above.
You have successfully corrected the availability data. Issue in fetching correct hard disk sizeThis error occurs because MSP Center Plus fails to identify the upgraded hard disk size. It continues to hold the old hard disk size in its database and keeps throwing the error. To manually update the correct hard disk size, follow the steps given below:From Probe End : - Go to the SubmitQuery page.
- Execute the following query and make a note of the "Name" of the device for which the hard disk is upgraded or changed.
select * from opmanagerobject
- Go to command prompt and connect to the <probe-home> \ mysql \ bin.
- Execute the command
update opmanagerobject set HARDDISKSIZE='Upgraded / Changed hard disk size' where name='Name of the device noted down from db'; - Again back to the SubmitQuer page execute the following command and check whether the hard disk space is updated manually
select * from opmanagerobject
From Central End :- Go to the SubmitQuery page.
- Execute the following query and make a note of the "Name" of the device for which the hard disk is upgraded or changed.
select * from opmanagerobject
- Goto command prompt and connect to the <central-home> \ mysql \ bin.
- Execute the command
update opmanagerobject set HARDDISKSIZE='Upgraded / Changed hard disk size' where name='Name of the device noted down from db'; - Again back to the SubmitQuery page execute the following command and check whether the hard disk space is updated manually.
select * from opmanagerobject
Once the above steps are done please restart the central and probe services.
|
|
|
| | | |
|